DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and STY17

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_195303.2 Gene:STY17 / 829731 AraportID:AT4G35780 Length:570 Species:Arabidopsis thaliana


Alignment Length:276 Identity:100/276 - (36%)
Similarity:147/276 - (53%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVL----QEAKLFWAL 183
            ||:..:|.|::.:..|.:.::.||.|..:||||||...      :|:...:|    ||..:...:
plant   286 EIDMKQLKIEKKVACGSYGELFRGTYCSQEVAIKILKP------ERVNAEMLREFSQEVYIMRKV 344

  Fly   184 KHENIAALRGVCLNT-KLCLVMEYARGGSLNRIL---AGKIPPDVLVNWAIQIARGMNYLHNEAP 244
            :|:|:....|.|..: .||:|.|:...||:...|   .|......|:..|:.:::||||||..  
plant   345 RHKNVVQFIGACTRSPNLCIVTEFMTRGSIYDFLHKHKGVFKIQSLLKVALDVSKGMNYLHQN-- 407

  Fly   245 MSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA-AGTYAWMPPEVISVST 308
             :|||||||::|:|:.|        .:.:|:.|||:||....:..|:| .|||.||.||||....
plant   408 -NIIHRDLKTANLLMDE--------HEVVKVADFGVARVQTESGVMTAETGTYRWMAPEVIEHKP 463

  Fly   309 YSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDP 373
            |...:||:||.::||||:|||.||....||..|.||....|...|||........|::.|||.||
plant   464 YDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVGVVQKGLRPKIPKETHPKLTELLEKCWQQDP 528

  Fly   374 HKRPGFKEILKQLESI 389
            ..||.|.||::.|..:
plant   529 ALRPNFAEIIEMLNQL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 97/265 (37%)
STKc_MLK 134..389 CDD:270963 96/263 (37%)
STY17NP_195303.2 ACT_TyrKc 178..244 CDD:153200
STKc_MAP3K-like 301..541 CDD:270901 95/256 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.