DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT3G50720

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_190641.1 Gene:AT3G50720 / 824236 AraportID:AT3G50720 Length:377 Species:Arabidopsis thaliana


Alignment Length:375 Identity:119/375 - (31%)
Similarity:173/375 - (46%) Gaps:58/375 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VGVFPKDFVTDEDPLQ--LNVSSAIGDIQPHEIEYNELDIK--EVIGSGGFCKVHRGYYDG-EEV 153
            :..|..|...||...|  .|:|        .|:..|..||.  |:||.||...|::|.... ..|
plant    17 MSAFGSDDNNDESDNQFDFNIS--------RELLLNPKDIMRGEMIGEGGNSIVYKGRLKNIVPV 73

  Fly   154 AIKIAHQTGE------DDMQRMRDNVLQEAKLFWALKHENIAALRGVCLNTKLCLVMEYARGGSL 212
            |:||. |.|:      .|.|:.:..||    :..::|||||....|.|:..:|.:|.|..|||:|
plant    74 AVKIV-QPGKTSAVSIQDKQQFQKEVL----VLSSMKHENIVRFVGACIEPQLMIVTELVRGGTL 133

  Fly   213 NRILAGKIPP----DVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTL 273
            .|.:....|.    .|.:::|:.|:|.|.|||::   .||||||...|||    :.|:   .|.:
plant   134 QRFMLNSRPSPLDLKVSLSFALDISRAMEYLHSK---GIIHRDLNPRNVL----VTGD---MKHV 188

  Fly   274 KITDFGLAREMYNTQRMSAAGTYAWMPPEVIS--------VSTYSKFSDVWSYGVLLWELITGET 330
            |:.|||||||.........||||.||.|||.|        ...|.:..||:|:.::.|.|:|.:|
plant   189 KLADFGLAREKTLGGMTCEAGTYRWMAPEVCSREPLRIGEKKHYDQKIDVYSFALIFWSLLTNKT 253

  Fly   331 PYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIA---CS 392
            |:.....:|:.|  .||....|.....|:....:::.||..|...|..||:|...|||:.   ||
plant   254 PFSEIPSISIPY--FVNQGKRPSLSNIPDEVVPILECCWAADSKTRLEFKDITISLESLLKRFCS 316

  Fly   393 -----KFTLTPQESFHYMQECWRKEIAGVLHDLREKEKRFQTIEEELRNK 437
                 :.|:|..|:  |..|....|...:|.....|.|:.:.|::.:..|
plant   317 ERSNNEITITEDEA--YDDEIEELETTWLLPKRYIKLKKPKKIKQNVMKK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 2/9 (22%)
TyrKc 129..386 CDD:197581 94/277 (34%)
STKc_MLK 134..389 CDD:270963 93/273 (34%)
AT3G50720NP_190641.1 STKc_MAP3K-like 54..304 CDD:270901 90/266 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.