DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT3G06640

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_187316.2 Gene:AT3G06640 / 819844 AraportID:AT3G06640 Length:730 Species:Arabidopsis thaliana


Alignment Length:311 Identity:108/311 - (34%)
Similarity:164/311 - (52%) Gaps:38/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LNVSSAI----------------GDIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKI- 157
            :|.:|||                .:...:||.:::|.|.|.||.|....|:.|.:.|.:||:|: 
plant   411 INANSAISRGIISHSTMNKVDTNSNCLEYEILWDDLTIGEQIGQGSCGTVYHGLWFGSDVAVKLI 475

  Fly   158 -AHQTGEDDMQRMRDNVLQEAKLFWALKHENIAALRG-VCLNTKLCLVMEYARGGSLNRIL---A 217
             ..:..|:.:|..|    ||..|...|:|.|:....| |.|...||:|.|:...|||.|:|   .
plant   476 SKQEYSEEVIQSFR----QEVSLMQRLRHPNVLLFMGAVTLPQGLCIVSEFLPRGSLFRLLQRNM 536

  Fly   218 GKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAR 282
            .|:.....:|.|:.|||||||||..:| .||||||||||:|:.:.:        |:|:.||||:|
plant   537 SKLDWRRRINMALDIARGMNYLHRCSP-PIIHRDLKSSNLLVDKNL--------TVKVADFGLSR 592

  Fly   283 EMYNT--QRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVA 345
            ..::|  ...|..|...||.|||:...:..:.||::|:||:||||.|.:.|::..:.:.|...|.
plant   593 IKHHTYLTSKSGKGMPQWMAPEVLRNESADEKSDIYSFGVVLWELATEKIPWENLNSMQVIGAVG 657

  Fly   346 VNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTL 396
            .....|.|||.....|.:|::|||..|...||.|:|::::|..:. .|:|:
plant   658 FMNQRLEIPKDIDPDWISLIESCWHRDAKLRPTFQELMERLRDLQ-RKYTI 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 99/264 (38%)
STKc_MLK 134..389 CDD:270963 97/262 (37%)
AT3G06640NP_187316.2 PAS 64..175 CDD:279347
PAS 73..175 CDD:238075
STYKc 446..698 CDD:214568 99/264 (38%)
STKc_MAP3K-like 452..698 CDD:270901 96/258 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.