DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT3G06620

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_187314.1 Gene:AT3G06620 / 819841 AraportID:AT3G06620 Length:773 Species:Arabidopsis thaliana


Alignment Length:396 Identity:118/396 - (29%)
Similarity:194/396 - (48%) Gaps:75/396 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQQQQQQQQLEQLHHPQIPEIPIPDLEQVETQVGD---------GSLWTALYDYDAQGEDELTLR 65
            :|.:|::::..|::    |...:    |.|:...:         .|||::..:.:          
plant   413 VQNEQKKERCHQIN----PSAGV----QYESHAFESNKPINNEASSLWSSPINAN---------- 459

  Fly    66 RGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNVSSAIGDIQPHEIEYNELD 130
                    ||.|  :...|..:..:.:||.       ||.:.|:            :||.:::|.
plant   460 --------STSS--ASSCGSTSSSVMNKVD-------TDSEGLE------------YEILWDDLT 495

  Fly   131 IKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHENIAALRG-V 194
            |.|.:|.|....|:.|.:.|.:||:|:..:  ::....:.::..||..|...|:|.|:....| |
plant   496 IGEQVGQGSCGTVYHGLWFGSDVAVKVFSK--QEYSAEVIESFKQEVLLMKRLRHPNVLLFMGAV 558

  Fly   195 CLNTKLCLVMEYARGGSLNRIL---AGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSN 256
            ....:||:|.|:...|||.|:|   ..|:.....::.|:.|||||||||:.:| .||||||||||
plant   559 TSPQRLCIVSEFLPRGSLFRLLQKSTSKLDWRRRIHMALDIARGMNYLHHCSP-PIIHRDLKSSN 622

  Fly   257 VLIYEAIEGNHLQQKTLKITDFGLAR---EMYNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSY 318
            :|:.        :..|:|:.||||:|   |.|.|.: |..||..||.|||:...:..:.||::|:
plant   623 LLVD--------KNWTVKVADFGLSRIKHETYLTSK-SGKGTPQWMAPEVLRNESADEKSDIYSF 678

  Fly   319 GVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEIL 383
            ||:||||.|.:.|::..:.:.|...|......|.|||.....|.:||:|||.:|...||.|:|::
plant   679 GVVLWELATEKIPWETLNSMQVIGAVGFMDQRLEIPKDIDPRWISLMESCWHSDTKLRPTFQELM 743

  Fly   384 KQLESI 389
            .:|..:
plant   744 DKLRDL 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 8/56 (14%)
TyrKc 129..386 CDD:197581 97/263 (37%)
STKc_MLK 134..389 CDD:270963 95/261 (36%)
AT3G06620NP_187314.1 PAS 103..210 CDD:395786
STKc_MAP3K-like 500..746 CDD:270901 94/257 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.