DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT2G43850

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_181913.3 Gene:AT2G43850 / 818989 AraportID:AT2G43850 Length:479 Species:Arabidopsis thaliana


Alignment Length:394 Identity:106/394 - (26%)
Similarity:168/394 - (42%) Gaps:81/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGSLWTALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGW---------WTGKI--------- 90
            ||.  |||:....:|      ..|.:..:||..:.:.....|         :.|.:         
plant   110 DGR--TALHIAACEG------HLGVVKALLSRRANIDARDRWGSTAAADAKYYGNLDVYNLLKAR 166

  Fly    91 GDKVGVFPKDFVTDEDPLQLNVSSAIGDIQPHEI---EYNELDIKEVIGSGGFCKVHRGYY---- 148
            |.||   ||   |.:.|:.::        .|.|:   |.|.|:: :|..|.|   :.:|.|    
plant   167 GAKV---PK---TRKTPMTVS--------NPREVPEYELNPLEV-QVRKSDG---ISKGAYQVAK 213

  Fly   149 -DGEEVAIKIAHQTGEDDMQRMRDNVLQ-EAKLFWALKHENIAALRG-VCLNTKLCLVMEYARGG 210
             :|..|::||..:....|.:|:  |..: |..|...::|.|:....| |..|..:.:|:||...|
plant   214 WNGTRVSVKILDKDSYSDPERI--NAFRHELTLLEKVRHPNVIQFVGAVTQNIPMMIVVEYNPKG 276

  Fly   211 SLNRIL--AGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTL 273
            .|:..|  .|::.|...:.:|:.|||||||||...|..|||.|||..|:|:....:        |
plant   277 DLSVYLQKKGRLSPSKALRFALDIARGMNYLHECKPDPIIHCDLKPKNILLDRGGQ--------L 333

  Fly   274 KITDFGLAREMYNTQRMSAAGTYA--------WMPPEVISVSTYSKFSDVWSYGVLLWELITGET 330
            ||:.||:.|....:|..:....:.        ::.|||.....:....|..|:||:|:|:..|..
plant   334 KISGFGMIRLSKISQDKAKVANHKAHIDLSNYYIAPEVYKDEIFDLRVDAHSFGVILYEITEGVP 398

  Fly   331 PYKGFDPLSVAYGVAVNTLTLPIPKT----CPETWGALMKSCWQTDPHKRPGFKEILKQLESIA- 390
            .:....|..||..:.:.. ..|:.||    .|.....|::.||..:...||.|.||:.:|:.|. 
plant   399 VFHPRPPEEVARMMCLEG-KRPVFKTKSRSYPPDIKELIEKCWHPEAGIRPTFSEIIIRLDKIVA 462

  Fly   391 -CSK 393
             |||
plant   463 NCSK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 14/74 (19%)
TyrKc 129..386 CDD:197581 79/277 (29%)
STKc_MLK 134..389 CDD:270963 79/275 (29%)
AT2G43850NP_181913.3 Ank_2 82..170 CDD:372319 12/67 (18%)
ANK repeat 82..108 CDD:293786
ANK repeat 110..141 CDD:293786 9/38 (24%)
ANK repeat 143..168 CDD:293786 2/24 (8%)
PKc_like 204..457 CDD:389743 75/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.