DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT2G42640

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_181792.4 Gene:AT2G42640 / 818864 AraportID:AT2G42640 Length:781 Species:Arabidopsis thaliana


Alignment Length:279 Identity:96/279 - (34%)
Similarity:144/279 - (51%) Gaps:40/279 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKI--AHQTGEDDMQRMRDNVLQEAKLFWALKHE 186
            |::::|.:...:|||....|.||.::..||||||  ..|...::|:..    ..|..:...|:|.
plant   523 IDFSKLKVGASVGSGTSGVVCRGVWNKTEVAIKIFLGQQLTAENMKVF----CNEISILSRLQHP 583

  Fly   187 NIAALRGVCLN-TKLCLVMEYARGGSLNRILAGKIPPDVLVNW------AIQIARGMNYLHNEAP 244
            |:..|.|.|.. .:|.||.||...|||..::..:...   ::|      ..:|.||:.|:|.   
plant   584 NVILLLGACTKPPQLSLVTEYMSTGSLYDVIRTRKKE---LSWQRKLKILAEICRGLMYIHK--- 642

  Fly   245 MSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNT--QRMSAAGTYAWMPPEVISVS 307
            |.|:||||.|:|.|:.::|         :||.||||:|.|..|  :...||||..||.||:|...
plant   643 MGIVHRDLTSANCLLNKSI---------VKICDFGLSRRMTGTAVKDTEAAGTPEWMAPELIRNE 698

  Fly   308 TYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMK---SCW 369
            ..::.||::|:||::|||.|...|:||.....|.:.||.....|.||:      |.|.|   .||
plant   699 PVTEKSDIFSFGVIMWELSTLSKPWKGVPKEKVIHIVANEGARLKIPE------GPLQKLIADCW 757

  Fly   370 QTDPHKRPGFKEILKQLES 388
             ::|.:||..||||.:|::
plant   758 -SEPEQRPSCKEILHRLKT 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 94/270 (35%)
STKc_MLK 134..389 CDD:270963 94/269 (35%)
AT2G42640NP_181792.4 EDR1 125..316 CDD:405130
STKc_MAP3K-like 534..773 CDD:270901 93/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.