DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and AT2G31010

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001189646.1 Gene:AT2G31010 / 817652 AraportID:AT2G31010 Length:775 Species:Arabidopsis thaliana


Alignment Length:320 Identity:102/320 - (31%)
Similarity:161/320 - (50%) Gaps:49/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PKDFVTDEDPLQLNVSSAIGD-----IQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKI 157
            |.:|...:...::..||.:.:     .|..:|:::||.:...:|.|.|.:|.||.::|.:||||:
plant   483 PSEFAVKDTWNKVVESSTLQNQPLLPYQEWDIDFSELTVGTRVGIGFFGEVFRGVWNGTDVAIKL 547

  Fly   158 AHQTGEDDM--QRMRDNVLQEAKLFWALKHENIAALRGVCLN-TKLCLVMEYARGGSLNRI--LA 217
            ..   |.|:  :.|.| ...|..:...::|.|:....|.|.. .:|.::.||...|||..:  ::
plant   548 FL---EQDLTAENMED-FCNEISILSRVRHPNVVLFLGACTKPPRLSMITEYMELGSLYYLIHMS 608

  Fly   218 GKIPPDVLVNW------AIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKIT 276
            |:   ...::|      ...|.||:..:|.   |.|:||||||:|.|:     ..|.   |:||.
plant   609 GQ---KKKLSWHRRLRMLRDICRGLMCIHR---MKIVHRDLKSANCLV-----DKHW---TVKIC 659

  Fly   277 DFGLAREM--YNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLS 339
            ||||:|.|  .|.:..|:|||..||.||:|....:::..|::|.||::|||.|...|::|..|..
plant   660 DFGLSRIMTDENMKDTSSAGTPEWMAPELIRNRPFTEKCDIFSLGVIMWELSTLRKPWEGVPPEK 724

  Fly   340 VAYGVAVNTLTLPIPKTCPETWGALMK---SCWQTDPHKRPGFKEILKQLESIACSKFTL 396
            |.:.||.....|.||.      |.|.|   .|| .:|.:||..:|||:.|  :.| ::||
plant   725 VVFAVAHEGSRLEIPD------GPLSKLIADCW-AEPEERPNCEEILRGL--LDC-EYTL 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 2/5 (40%)
TyrKc 129..386 CDD:197581 91/272 (33%)
STKc_MLK 134..389 CDD:270963 91/270 (34%)
AT2G31010NP_001189646.1 EDR1 48..245 CDD:405130
STKc_MAP3K-like 525..764 CDD:270901 88/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.