DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and STY8

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_179361.1 Gene:STY8 / 816278 AraportID:AT2G17700 Length:546 Species:Arabidopsis thaliana


Alignment Length:279 Identity:104/279 - (37%)
Similarity:155/279 - (55%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVL----QEAKLFWAL 183
            ||:..:|.|::.:.||.:..:|||.|..:|||||....      .|:.:.:|    ||..:...:
plant   280 EIDVTQLKIEKKVASGSYGDLHRGTYCSQEVAIKFLKP------DRVNNEMLREFSQEVFIMRKV 338

  Fly   184 KHENIAALRGVCLNT-KLCLVMEYARGGSLNRIL-----AGKIPPDVLVNWAIQIARGMNYLHNE 242
            :|:|:....|.|..: .||:|.|:...||:...|     |.|:  ..|:..|:.:|:||:|||..
plant   339 RHKNVVQFLGACTRSPTLCIVTEFMARGSIYDFLHKQKCAFKL--QTLLKVALDVAKGMSYLHQN 401

  Fly   243 APMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA-AGTYAWMPPEVISV 306
               :|||||||::|:|:.|        ...:|:.|||:||....:..|:| .|||.||.||||..
plant   402 ---NIIHRDLKTANLLMDE--------HGLVKVADFGVARVQIESGVMTAETGTYRWMAPEVIEH 455

  Fly   307 STYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIP-KTCPETWGALMKSCWQ 370
            ..|:..:||:||.::||||:||:.||....||..|.||....|...|| ||.|:..| |::.||.
plant   456 KPYNHKADVFSYAIVLWELLTGDIPYAFLTPLQAAVGVVQKGLRPKIPKKTHPKVKG-LLERCWH 519

  Fly   371 TDPHKRPGFKEILKQLESI 389
            .||.:||.|:||::.|:.|
plant   520 QDPEQRPLFEEIIEMLQQI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 100/268 (37%)
STKc_MLK 134..389 CDD:270963 99/266 (37%)
STY8NP_179361.1 ACT_TyrKc 172..239 CDD:153200
Pkinase_Tyr 286..535 CDD:285015 100/268 (37%)
STKc_MAP3K-like 292..535 CDD:270901 98/262 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1208
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.