DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and MAP3K7

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_663304.1 Gene:MAP3K7 / 6885 HGNCID:6859 Length:606 Species:Homo sapiens


Alignment Length:530 Identity:149/530 - (28%)
Similarity:226/530 - (42%) Gaps:127/530 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SSAIGD--------IQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRM 169
            ||:.|:        :...||:|.|::::||:|.|.|..|.:..:..::||||......|      
Human    12 SSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE------ 70

  Fly   170 RDNVLQEAKLFWALKHENIAALRGVCLNTKLCLVMEYARGGSLNRILAGKIPPDV-----LVNWA 229
            |...:.|.:....:.|.||..|.|.||| .:|||||||.||||..:|.|..|...     .::|.
Human    71 RKAFIVELRQLSRVNHPNIVKLYGACLN-PVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWC 134

  Fly   230 IQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAG 294
            :|.::|:.|||:..|.::||||||..|:|:   :.|.    ..|||.|||.|.:: .|...:..|
Human   135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLL---VAGG----TVLKICDFGTACDI-QTHMTNNKG 191

  Fly   295 TYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYK--GFDPLSVAYGVAVNTLTLPIPKTC 357
            :.|||.|||...|.||:..||:|:|::|||:||...|:.  |.....:.:.|. |....|:.|..
Human   192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVH-NGTRPPLIKNL 255

  Fly   358 PETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTPQESFHYMQECWRKEIAGVLHDLRE 422
            |:...:||..||..||.:||..:||:|.:.               |.|                 
Human   256 PKPIESLMTRCWSKDPSQRPSMEEIVKIMT---------------HLM----------------- 288

  Fly   423 KEKRFQTIEEELR-----NKEEQLLRVQNEQREKANLLKIREQNLRERERVLIERELVMLQPVPS 482
              :.|...:|.|:     :.|.|    .|......:.:.|...|...:....:|:       ||:
Human   289 --RYFPGADEPLQYPCQYSDEGQ----SNSATSTGSFMDIASTNTSNKSDTNMEQ-------VPA 340

  Fly   483 -----KRKHKKGKKNKPLQISLPTGFRHTITAVRDKAEQPGSPSFSGLRI----------VALTD 532
                 ||...|..||:..|.| .:| |.::.|.|..:.:...|:..|.|:          :|.|.
Human   341 TNDTIKRLESKLLKNQAKQQS-ESG-RLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATT 403

  Fly   533 GHKGKTWGPSTMHQRERSL-----LPS-QLSG-GQPE------------WPAQTSTHSS------ 572
            .:.    .|...|::..|.     :|. .:|| |||.            .|.|.|:.||      
Human   404 AYS----KPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRM 464

  Fly   573 FSKSAPNLDK 582
            .:.|.|..:|
Human   465 ITTSGPTSEK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 96/263 (37%)
STKc_MLK 134..389 CDD:270963 95/261 (36%)
MAP3K7NP_663304.1 Interaction with MAPK8IP1. /evidence=ECO:0000250 1..300 108/337 (32%)
STKc_TAK1 42..292 CDD:270960 96/299 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..338 6/47 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..391 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..493 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.