DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and map3k7

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_009292938.1 Gene:map3k7 / 553788 ZFINID:ZDB-GENE-041001-135 Length:578 Species:Danio rerio


Alignment Length:269 Identity:98/269 - (36%)
Similarity:146/269 - (54%) Gaps:23/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHEN 187
            ||:|.:::::||:|.|.|..|.:..:.|.:||||......|      ::..:.|.:....:.|.|
Zfish    19 EIDYVDIEVEEVVGRGAFGVVCKAKWKGRDVAIKTIESESE------KNAFIVELRQLSRVDHPN 77

  Fly   188 IAALRGVCLNTKLCLVMEYARGGSLNRILAGKIP-----PDVLVNWAIQIARGMNYLHNEAPMSI 247
            |..|.|.| |..:|||||||.||||..:|.|..|     ....::|.:|.::|::|||...|.::
Zfish    78 IVKLYGSC-NNPVCLVMEYAEGGSLYNVLHGAEPLPHYTASHAMSWCLQCSQGVSYLHGMKPKAL 141

  Fly   248 IHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYSKF 312
            ||||||..|:|:   :.|.    ..|||.|||.|.:: .|...:..|:.|||.|||...|.||:.
Zfish   142 IHRDLKPPNLLL---VAGG----TVLKICDFGTACDI-QTHMTNNKGSAAWMAPEVFEGSNYSEK 198

  Fly   313 SDVWSYGVLLWELITGETPYK--GFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHK 375
            .||:|:|::|||:||...|:.  |.....:.:.|...|.. |:.|..|:...:||..||..||.:
Zfish   199 CDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHRGTRP-PLIKNLPKAIESLMTRCWSKDPSQ 262

  Fly   376 RPGFKEILK 384
            ||..:||:|
Zfish   263 RPSMEEIVK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 95/263 (36%)
STKc_MLK 134..389 CDD:270963 94/258 (36%)
map3k7XP_009292938.1 TyrKc 25..273 CDD:197581 95/263 (36%)
STKc_TAK1 31..281 CDD:270960 93/257 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.