DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and grap2a

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001017756.1 Gene:grap2a / 550452 ZFINID:ZDB-GENE-050417-275 Length:284 Species:Danio rerio


Alignment Length:52 Identity:18/52 - (34%)
Similarity:30/52 - (57%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDF 101
            |:||:.|:.:|||....|:|:.||.     ..|..||.|::..:.|:||.::
Zfish   234 AIYDFTAEEDDELGFNSGDIIEVLD-----RSDASWWKGRLRGRSGLFPANY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 18/52 (35%)
STKc_MLK 134..389 CDD:270963
grap2aNP_001017756.1 SH3_GRAP2_N 2..53 CDD:212880
SH2_Grb2_like 54..147 CDD:199828
SH3_GRAP2_C 231..283 CDD:212883 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.