DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Ilk

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:123/279 - (44%) Gaps:32/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IEYNELDIK---EVIGSGGFCKVHRGYYDGEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALK 184
            |...:||:.   .|..||   :..||.:...:|..|| |.:.....:.|..:....:.::|   .
  Fly   187 ISMGDLDLHTKLSVTPSG---ETWRGRWQKNDVVAKILAVRQCTPRISRDFNEEFPKLRIF---S 245

  Fly   185 HENIAALRGVCLN-TKLCLVMEYARGGSLNRILAGK----IPPDVLVNWAIQIARGMNYLHN-EA 243
            |.||..:.|.|.: ..|..:.::....||..:|.|.    :.....|::|:.:||||.:||: |.
  Fly   246 HPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALDVARGMAFLHSLER 310

  Fly   244 PMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVST 308
            .:...|  |.|.:|:|.:.:        |.:| :.|.|:  ::.|........|||.||.:....
  Fly   311 IIPTYH--LNSHHVMIDDDL--------TARI-NMGDAK--FSFQEKGRIYQPAWMSPETLQRKQ 362

  Fly   309 YSK---FSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQ 370
            ..:   ..|:||:.:|:|||.|.|.|:..:.|:.....:|:..|.:.||.........|:..|..
  Fly   363 ADRNWEACDMWSFAILIWELTTREVPFAEWSPMECGMKIALEGLRVKIPPGTSTHMAKLISICMN 427

  Fly   371 TDPHKRPGFKEILKQLESI 389
            .||.|||.|..::..||.:
  Fly   428 EDPGKRPKFDMVVPILEKM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
STKc_MLK 134..389 CDD:270963 70/264 (27%)
IlkNP_525001.2 ANKYR <1..162 CDD:440430
ANK repeat 33..64 CDD:293786
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 70/268 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.