DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Pbk

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_075698.1 Gene:Pbk / 52033 MGIID:1289156 Length:330 Species:Mus musculus


Alignment Length:276 Identity:71/276 - (25%)
Similarity:107/276 - (38%) Gaps:79/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DDMQR--MRDNVLQEAKLFWALKHENIAALRGV--CLNTKLCLVMEYARGGSLNRIL-------A 217
            ||..|  .:..:..|||:...|.|.||...|..  ..:..|||.|||....|||.::       .
Mouse    70 DDHYRTVYQKRLTDEAKILKNLNHPNIIGYRAFTEASDGSLCLAMEYGGEKSLNDLIEERNKDSG 134

  Fly   218 GKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAR 282
            ...|..|::..|:.:|||:.|||.|  ..::|.|:|||||:|....|       |:||.|.|::.
Mouse   135 SPFPAAVILRVALHMARGLKYLHQE--KKLLHGDIKSSNVVIKGDFE-------TIKICDVGVSL 190

  Fly   283 EMYNTQRMSAA-------GTYAWMPPEVISVS-TYSKFSDVWSYGVLLWELIT------------ 327
            .:  .:.|:..       ||..|.|.|.:..: ..:..:||:::|:.|||::|            
Mouse   191 PL--DENMTVTDPEACYIGTEPWKPKEALEENGIITDKADVFAFGLTLWEMMTLCIPHVNLPDDD 253

  Fly   328 ---------------------GETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQT 371
                                 |..|....:.|..:|..|:.                |...|...
Mouse   254 VDEDATFDESDFDDEAYYAALGTRPSINMEELDDSYQKAIE----------------LFCVCTNE 302

  Fly   372 DPHKRPGFKEILKQLE 387
            ||..||....|::.||
Mouse   303 DPKDRPSAAHIVEALE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 69/273 (25%)
STKc_MLK 134..389 CDD:270963 71/276 (26%)
PbkNP_075698.1 PKc_TOPK 31..318 CDD:270903 69/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.