DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and TNNI3K

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_057062.1 Gene:TNNI3K / 51086 HGNCID:19661 Length:835 Species:Homo sapiens


Alignment Length:428 Identity:118/428 - (27%)
Similarity:185/428 - (43%) Gaps:90/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VETQVGDGSLWTALYDYDAQGEDELT---LRRGEIVVVLSTD-SEVSGD------VGWWTGKIGD 92
            :..|..||.  |.|:.....|...|.   |..|..:.:::.| |..||:      :.|...|..|
Human   333 INHQGRDGH--TGLHSACYHGHIRLVQFLLDNGADMNLVACDPSRSSGEKDEQTCLMWAYEKGHD 395

  Fly    93 KVGVFPKDFVTDEDPLQLN-------------VSSAIGDIQP------------------HEIEY 126
            .:....|.:...:|.|..|             |.|.:|.|:.                  ..::.
Human   396 AIVTLLKHYKRPQDELPCNEYSQPGGDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQL 460

  Fly   127 NELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNV----------LQEAKLFW 181
            :|::..|:||||.|.||::|....:.||||           |.|.|.          .:|..:..
Human   461 SEIEFHEIIGSGSFGKVYKGRCRNKIVAIK-----------RYRANTYCSKSDVDMFCREVSILC 514

  Fly   182 ALKHENIAALRGVCLN--TKLCLVMEYARGGSL-------NRILAGKIPPDVLVNWAIQIARGMN 237
            .|.|..:....|.|||  ::..:|.:|..||||       .|||  .:...:::  |:.:|:||.
Human   515 QLNHPCVIQFVGACLNDPSQFAIVTQYISGGSLFSLLHEQKRIL--DLQSKLII--AVDVAKGME 575

  Fly   238 YLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQR---MSAAGTYAWM 299
            |||| ....||||||.|.|:|:||  :|:.:      :.|||.:|.:.:...   ....|...||
Human   576 YLHN-LTQPIIHRDLNSHNILLYE--DGHAV------VADFGESRFLQSLDEDNMTKQPGNLRWM 631

  Fly   300 PPEVISVST-YSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGA 363
            .|||.:..| |:..:||:||.:.|||::|||.|:....|.:.|..:|.:.:..||..:.|:...:
Human   632 APEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISS 696

  Fly   364 LMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTPQES 401
            |:...|...|..||.|.|::.:||...|:...::|..|
Human   697 LLIRGWNACPEGRPEFSEVVMKLEECLCNIELMSPASS 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 14/66 (21%)
TyrKc 129..386 CDD:197581 88/279 (32%)
STKc_MLK 134..389 CDD:270963 89/277 (32%)
TNNI3KNP_057062.1 ANK <56..121 CDD:238125
ANK repeat 66..98 CDD:293786
ANK 1 66..96
ANK 99..220 CDD:238125
ANK repeat 100..131 CDD:293786
ANK 2 100..129
ANK 3 133..162
ANK repeat 134..164 CDD:293786
ANK 161..290 CDD:238125
ANK repeat 166..197 CDD:293786
ANK 4 166..195
ANK repeat 199..232 CDD:293786
ANK 5 199..228
ANK 229..360 CDD:238125 7/28 (25%)
ANK 6 234..263
ANK repeat 234..262 CDD:293786
ANK repeat 269..302 CDD:293786
ANK 7 269..298
ANK repeat 304..337 CDD:293786 0/3 (0%)
ANK 8 304..335 0/1 (0%)
ANK 334..>401 CDD:238125 16/68 (24%)
ANK repeat 339..369 CDD:293786 8/31 (26%)
ANK 9 339..368 8/30 (27%)
ANK 10 381..410 4/28 (14%)
PKc_TNNI3K 469..722 CDD:270966 89/276 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..751 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.