DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and grb2a

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001007770.1 Gene:grb2a / 493609 ZFINID:ZDB-GENE-041121-1 Length:217 Species:Danio rerio


Alignment Length:79 Identity:27/79 - (34%)
Similarity:43/79 - (54%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLEQVETQVGDGSLWTALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFP 98
            |:|||..   :.:...||:|:|.|.:.||..|||:.:.||.     :.|..||.|....:.|:||
Zfish   150 DIEQVPQ---NSTYVQALFDFDPQEDGELGFRRGDFIQVLD-----NSDPNWWKGACHGQTGMFP 206

  Fly    99 KDFVTDEDPLQLNV 112
            :::||   |:..|:
Zfish   207 RNYVT---PVNQNM 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 20/56 (36%)
STKc_MLK 134..389 CDD:270963
grb2aNP_001007770.1 SH3_GRB2_N 1..56 CDD:212879
SH2_Grb2_like 56..150 CDD:199828 27/79 (34%)
SH3_GRB2_C 160..212 CDD:212882 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.