DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Takl2

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:289 Identity:87/289 - (30%)
Similarity:142/289 - (49%) Gaps:26/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHENI 188
            :.|.|:..||:||:|.:..|:|..:...|:|:|...:..||  :::...:.|..|    ..|.||
  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCED--KKIEREIYQLTK----ASHVNI 66

  Fly   189 AALRGVCLNTKLC-LVMEYARGGSLNRILAGKIPPDV----LVNWAIQIARGMNYLHNEAPMSII 248
            ..|.|...:.... |:||:..||||:..|..|..|..    ..|||.|||:|:.|||...|.::|
  Fly    67 VELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVI 131

  Fly   249 HRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA-AGTYAWMPPEVISVSTYSKF 312
            |||:|..|.|:.|       :...|||.|||...::  :|.:|. |||..:..|||:..:...:.
  Fly   132 HRDIKPLNTLLCE-------KGLKLKICDFGTVVDL--SQSISCNAGTCRYKAPEVLQGNKPDEK 187

  Fly   313 SDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLP----IPKTCPETWGALMKSCWQTDP 373
            .||:|:.:..||:::.:.|::.::.|...| :|:|....|    |...||....||:.:.|..|.
  Fly   188 CDVYSWAITFWEILSRKEPFEQYNTLFELY-MAINEGERPDLSCIMSGCPADIVALLYASWDPDI 251

  Fly   374 HKRPGFKEILKQLESIACSKFTLTPQESF 402
            .||...:.|.:.:..|.....::.|.:.:
  Fly   252 SKRFSMELISQSMGRILSEAGSIPPLDFY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 83/266 (31%)
STKc_MLK 134..389 CDD:270963 81/264 (31%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 82/259 (32%)
PKc_like 19..268 CDD:304357 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445267
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.