DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and LOC405768

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001353900.1 Gene:LOC405768 / 405768 -ID:- Length:477 Species:Danio rerio


Alignment Length:348 Identity:121/348 - (34%)
Similarity:182/348 - (52%) Gaps:49/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVIGSGGFCKVHRGYY--DGEEVAIKIAHQTGEDDMQRMRDNVLQ---EAKLFWA 182
            :|.::::...|..|.|.|..|:|.::  ..:|||:|               .:|:   ||::...
Zfish    41 QIPFDDIRFYENCGGGSFGSVYRAHWVPQDKEVAVK---------------KLLKIDAEAEILSV 90

  Fly   183 LKHENIAALRGVCLNT-KLCLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHNE 242
            |.|:||....|..|.. ...:|.|||..|||...|:.    ::..|.::.||::||:||:|||.|
Zfish    91 LSHKNIIQFYGAILEAPNYGIVTEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHAE 155

  Fly   243 APMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVS 307
            ||:.:|||||||.||::        .....|||.|||.::.:.:|..||..||:.||.||||...
Zfish   156 APLKVIHRDLKSRNVVL--------TADNVLKICDFGASKMVSHTTHMSLVGTFPWMAPEVIQSL 212

  Fly   308 TYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTD 372
            ..|:..|.:||||:|||::|.|.|:|||:.|.||:.|........||.:||.::..||:.||..:
Zfish   213 PVSETCDTYSYGVVLWEMLTREVPFKGFEGLQVAWLVVEKHERPTIPSSCPASFADLMRRCWNAE 277

  Fly   373 PHKRPGFKEILKQLESI--------ACSKFTLTPQESFHYMQECWRKEIAGVLHDLREKEKRFQT 429
            |.:||.||:||..||::        .|:.|       .|...| ||.||...|..|::.|:....
Zfish   278 PKERPQFKQILSTLETMKNDSKLPDQCNSF-------LHNKAE-WRCEIEETLERLKQLERELSC 334

  Fly   430 IEEELRNKEEQLLRVQNEQREKA 452
            .|:||..:|.:|...:|...|::
Zfish   335 KEQELEERERRLTEWENRLMERS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 100/266 (38%)
STKc_MLK 134..389 CDD:270963 101/264 (38%)
LOC405768NP_001353900.1 STKc_MLTK 53..294 CDD:270962 101/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.