DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and dstyk

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_005168327.1 Gene:dstyk / 402922 ZFINID:ZDB-GENE-040826-2 Length:885 Species:Danio rerio


Alignment Length:422 Identity:96/422 - (22%)
Similarity:156/422 - (36%) Gaps:149/422 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QQLEQLHHPQIPEIPIPDLEQVETQVGDGSLW------------------TALYDYDAQGEDEL- 62
            :|||:.|..:        ||:.|      .||                  .:|.|....|:.:| 
Zfish   567 RQLEEGHTGR--------LERTE------DLWLRVRKDHAPRLARLSLESRSLRDILLHGKPKLG 617

  Fly    63 -TLRRGEIVVVLSTDSEVSGDVGWWTGK--IGDKVGVFPKDFVTDEDPLQLNVSSAIGDIQPHEI 124
             .|.||:..||...||        |.|:  ...|..|.|.|...::..|:.:.:.:   :..||.
Zfish   618 RELGRGQYGVVYLCDS--------WAGRHPCALKSVVPPDDKHWNDLALEFHYTRS---LPKHER 671

  Fly   125 EYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRM-RDNVLQEAKLFWALKHENI 188
            ..|      :.||    .:...|..|..:|:.:.       |:|: ||       |:..||    
Zfish   672 LVN------LHGS----VIDHSYSGGSSIAVLLI-------MERLHRD-------LYTGLK---- 708

  Fly   189 AALRGVCLNTKLCLVMEYARGGSLNRILAGKIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLK 253
               .|:.|..:|.:                          |:.:..|:.:||::   .::|||:|
Zfish   709 ---AGLSLKERLLI--------------------------ALDVVEGIRFLHSQ---GLLHRDIK 741

  Fly   254 SSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRM---SAAGTYAWMPPEVISVSTYSKFSDV 315
            ..|||:.        :|...||||.|..:    .:.|   |..||...|.||:.: ..|....||
Zfish   742 LKNVLLD--------KQNRAKITDLGFCK----PEAMMSGSIVGTPIHMAPELFT-GKYDNSVDV 793

  Fly   316 WSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTC---------PETWGALMKSCWQT 371
            :::|:|.|.|.:|....    |.:.....:.:.|...:.|.|         .|.| .||::||..
Zfish   794 YAFGILFWYLCSGSVKL----PEAFEKCASKDQLWTNVKKGCRPERLPVFDEECW-QLMEACWNG 853

  Fly   372 DPHKR-------PGFKEILKQLESIACSKFTL 396
            ||.:|       ||.:.|:::|    |.:.:|
Zfish   854 DPSQRPLLGIVQPGLQSIMERL----CGEKSL 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 19/78 (24%)
TyrKc 129..386 CDD:197581 63/276 (23%)
STKc_MLK 134..389 CDD:270963 64/274 (23%)
dstykXP_005168327.1 PKc_Dusty 613..874 CDD:270877 81/349 (23%)
S_TKc 615..859 CDD:214567 77/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.