DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Grap

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_063125579.1 Gene:Grap / 363616 RGDID:1306884 Length:240 Species:Rattus norvegicus


Alignment Length:61 Identity:22/61 - (36%)
Similarity:36/61 - (59%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQL 110
            |.:|:.||...:|:||||:||.::..:     |..||.|:.|.::|.||:.:|   .|:.|
  Rat   188 AQFDFSAQDPSQLSLRRGDIVEIVECE-----DPHWWRGRAGGRLGFFPRSYV---QPVHL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 20/53 (38%)
STKc_MLK 134..389 CDD:270963
GrapXP_063125579.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.