DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Ripk2

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001178794.1 Gene:Ripk2 / 362491 RGDID:1309167 Length:539 Species:Rattus norvegicus


Alignment Length:304 Identity:91/304 - (29%)
Similarity:147/304 - (48%) Gaps:44/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 AIGDIQPHEIEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAH---QTGEDDMQRMRDNVLQE 176
            ||....|| |.|::|.....:..|....|....:....|.:.:.|   .|...|.:  |:::|:|
  Rat     5 AICSALPH-IPYHKLADLHYLSRGASGTVSSARHADWRVRVAVKHLHIHTPLLDSE--RNDILRE 66

  Fly   177 AKLFWALKHENIAALRGVCLNTK-LCLVMEYARGGSLNRILAGKIP-PDVLVNWAI------QIA 233
            |::....:...|..:.|:|...: |.:|.||...||||.:|..|.. |::.  |.:      :||
  Rat    67 AEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPEIA--WPLRFRILHEIA 129

  Fly   234 RGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLA--REMYNTQRMS----- 291
            .|:|||||..| .::|.|||:.|:|:.....        :||.||||:  |.|..:|..|     
  Rat   130 LGVNYLHNMNP-PLLHHDLKTQNILLDNEFH--------VKIADFGLSKWRMMSLSQSRSYKSAP 185

  Fly   292 AAGTYAWMPPEVISVSTYSKFS---DVWSYGVLLWELITGETPYKGF-DPLSVAYGVA----VNT 348
            ..||..:||||.......|:.|   |::||.|::||:::.:.|::.. :||.:.|.|:    .||
  Rat   186 EGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMYSVSQGHRPNT 250

  Fly   349 LTLPIPKTCPETWG---ALMKSCWQTDPHKRPGFKEILKQLESI 389
            ....:|...|.. |   :|::|.|..:|.:||.|.:.|.:||.:
  Rat   251 SEENLPFDIPHR-GLMISLIQSGWAQNPDERPSFLKCLIELEPV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 83/285 (29%)
STKc_MLK 134..389 CDD:270963 84/283 (30%)
Ripk2NP_001178794.1 STKc_RIP2 20..303 CDD:270928 84/288 (29%)
STYKc 21..290 CDD:214568 82/282 (29%)
CARD_RIP2_CARD3 437..523 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.