DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and pbk

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001002387.1 Gene:pbk / 360218 ZFINID:ZDB-GENE-030523-2 Length:339 Species:Danio rerio


Alignment Length:277 Identity:73/277 - (26%)
Similarity:119/277 - (42%) Gaps:64/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 KIAHQTGEDDMQRMRDNVLQEAKLFWALKHENIAALRG--VCLNTKLCLVMEYARGGSLNRILAG 218
            ||..:..:..:...:..:.:|||:...|||.||...|.  ...:...||.||:....|||.::..
Zfish    68 KINSKCAQGQVSVYQKRLCEEAKILKDLKHPNIVGFRAFTTAKDGSKCLAMEFGGEQSLNDLIEK 132

  Fly   219 K-------IPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKIT 276
            :       .|.|.:...|:.:|||:.|||||  ..::|.|:||.||:|....|       ::||.
Zfish   133 RREEGLQAFPVDTIEKVALHVARGLLYLHNE--KKLLHGDMKSCNVVIKGDFE-------SIKIC 188

  Fly   277 DFGLAREMYNTQRMS-----AAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPY---- 332
            |.|::..:....::|     ..||..|.|.|.:.....:..:|:::||:.|||::|...|:    
Zfish   189 DVGVSLPLDENMQVSDPKAHYIGTEPWKPKEALEDGVITDKADIFAYGLTLWEMMTLSVPHLEML 253

  Fly   333 --------------KGFDPLSVAY------GVAVNTLTLPIPKTCPETWGALMKS------CWQT 371
                          :.||  ..||      ..|::.:||         .|:..:.      |.:.
Zfish   254 DTEGDEDDDDESFEEDFD--EDAYYERLGSRPALDAVTL---------GGSYQRMVELFCLCTEE 307

  Fly   372 DPHKRPGFKEILKQLES 388
            ||.|||....|::.|||
Zfish   308 DPQKRPSAAHIVQVLES 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 70/273 (26%)
STKc_MLK 134..389 CDD:270963 73/277 (26%)
pbkNP_001002387.1 PKc_TOPK 36..325 CDD:270903 73/277 (26%)
Pkinase_Tyr 38..322 CDD:285015 70/273 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.