DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Takl1

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:412 Identity:118/412 - (28%)
Similarity:191/412 - (46%) Gaps:68/412 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EIEYNELDIKEVI---GSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALK 184
            ::::.|:.:.|..   ||||  .|.:..:..:|:|:||.....|    .::.|..:|......:.
  Fly     4 QVDFAEVKLSEKFLGAGSGG--AVRKATFQNQEIAVKIFDFLEE----TIKKNAEREITHLSEID 62

  Fly   185 HENIAALRGVCLNTKL-CLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHN-EA 243
            |||:..:.|...|.|. .|:|||...|||:..|.|    :...:..|.||:|.|:.:.|||: :.
  Fly    63 HENVIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLDR 127

  Fly   244 PMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVST 308
            |  |:|||:|..|:|:|.       |.:.|||.|||||.:|.| .:....||..:|.||.|....
  Fly   128 P--IVHRDIKPQNMLLYN-------QHEDLKICDFGLATDMSN-NKTDMQGTLRYMAPEAIKHLK 182

  Fly   309 YSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGV--AVNT-LTLP---IPKTCPETWGALMKS 367
            |:...||:|:|::||||:|.:.||...:..:..|.:  |::: ..||   :...|||....||:.
  Fly   183 YTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMEC 247

  Fly   368 CWQTDPHKRPGFKEILKQL------------------ESIACSKFTLTPQESFHYMQECWRKEIA 414
            |...:|.|||..|||.|.|                  :::|...:.:....|.....:.||.::.
  Fly   248 CMDINPEKRPSMKEIEKFLGEQYESGTDEDFIKPLDEDTVAVVTYHVDSSGSRIMRVDFWRHQLP 312

  Fly   415 GVLHDL----REKEKRFQTIEEEL----RNKEEQLLRVQNE-QREKANLLKIREQNLRERERVLI 470
            .:....    ||.|:..:|:..|:    .:.:.::.|.:.: :||.:......|:..| |....:
  Fly   313 SIRMTFPIVKREAERLGKTVVREMAKAAADGDREVRRAEKDTERETSRAAHNGERETR-RAGQDV 376

  Fly   471 ERELVMLQPVPSKRKHKK-GKK 491
            .||.|        |..|| |||
  Fly   377 GRETV--------RAVKKIGKK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 92/271 (34%)
STKc_MLK 134..389 CDD:270963 92/287 (32%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 88/262 (34%)
STKc_TAK1 17..274 CDD:270960 92/272 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.