DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Dstyk

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_955750.1 Gene:Dstyk / 304791 RGDID:735051 Length:927 Species:Rattus norvegicus


Alignment Length:227 Identity:60/227 - (26%)
Similarity:100/227 - (44%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 KHENIAALRGVCL--------NTKLCLVMEYARGGSLNRILAGKIPPDVLVNWAIQIARGMNYLH 240
            |||.:..|.|..:        :..:.|:||.........:.|| :..:..:..|:.:..|:.:||
  Rat   704 KHERLVDLHGSVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LSLETRLQIALDVVEGIRFLH 767

  Fly   241 NEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRM---SAAGTYAWMPPE 302
            ::   .::|||:|..|||:.        :|...||||.|..:    .:.|   |..||...|.||
  Rat   768 SQ---GLVHRDIKLKNVLLD--------KQNRAKITDLGFCK----PEAMMSGSIVGTPIHMAPE 817

  Fly   303 VISVSTYSKFSDVWSYGVLLWELITGETPY-KGFDPLSVAYGVAVNTLTLPIPKTCP----ETWG 362
            :.: ..|....||:::|:|.|.:.:|.... :.|:..:....:..|......|:..|    |.| 
  Rat   818 LFT-GKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECW- 880

  Fly   363 ALMKSCWQTDPHKRP--GF-KEILKQLESIAC 391
            .||::||..||.|||  |. :.||:.:....|
  Rat   881 QLMEACWDGDPSKRPLLGIVQPILRSIMDRLC 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 59/220 (27%)
STKc_MLK 134..389 CDD:270963 59/223 (26%)
DstykNP_955750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 649..910 CDD:270877 59/223 (26%)
S_TKc 651..895 CDD:214567 54/208 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.