DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and DSTYK

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_056190.1 Gene:DSTYK / 25778 HGNCID:29043 Length:929 Species:Homo sapiens


Alignment Length:229 Identity:62/229 - (27%)
Similarity:98/229 - (42%) Gaps:48/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 KHENIAALRGVCLNTKLCLVMEYARGGS-----------LNRILAGKIPPDVLVNWAIQIA---- 233
            |||.:..|.|        .|::|..||.           |:|.|...:...:.:...:|||    
Human   706 KHERLVDLHG--------SVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVV 762

  Fly   234 RGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRM---SAAGT 295
            .|:.:||::   .::|||:|..|||:.        :|...||||.|..:    .:.|   |..||
Human   763 EGIRFLHSQ---GLVHRDIKLKNVLLD--------KQNRAKITDLGFCK----PEAMMSGSIVGT 812

  Fly   296 YAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPY-KGFDPLSVAYGVAVNTLTLPIPKTCP- 358
            ...|.||:.: ..|....||:::|:|.|.:.:|.... :.|:..:....:..|......|:..| 
Human   813 PIHMAPELFT-GKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPV 876

  Fly   359 ---ETWGALMKSCWQTDPHKRPGFKEILKQLESI 389
               |.| .||::||..||.|||....:...|:.|
Human   877 FDEECW-QLMEACWDGDPLKRPLLGIVQPMLQGI 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 60/224 (27%)
STKc_MLK 134..389 CDD:270963 61/227 (27%)
DSTYKNP_056190.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 651..912 CDD:270877 62/229 (27%)
S_TKc 653..897 CDD:214567 58/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.