DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Mos

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_064487.3 Gene:Mos / 24559 RGDID:3103 Length:342 Species:Rattus norvegicus


Alignment Length:309 Identity:81/309 - (26%)
Similarity:146/309 - (47%) Gaps:73/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 IEYNELDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWA------ 182
            |::.::.:...:|||||..|::..|.|..||||        .:.:...|:....:.|||      
  Rat    57 IDWGQVCLLHRLGSGGFGSVYKATYHGVPVAIK--------QVNKCTRNLRASQRSFWAELNIAR 113

  Fly   183 LKHENIAALRGVCLNTKL--------CLVMEYARGGSLNRILAGKI-PPDVL-----------VN 227
            |.|:||  :|.|..:|:.        .::||:....:|::::.|.. .|:.|           :.
  Rat   114 LHHDNI--VRVVAASTRTPEGSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLK 176

  Fly   228 WAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSA 292
            :::.|..|:.:||::   ||:|.|||.:|:||.|        :...||:|||.::::.:.:...|
  Rat   177 YSLDIVNGLLFLHSQ---SILHLDLKPANILISE--------KDVCKISDFGCSQKLQDLRCRQA 230

  Fly   293 A-----GTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLP 352
            :     |||....||::.....:..:|::|:|:.||::.|.|.||.| :|..|.|.|....|.  
  Rat   231 SLHHIGGTYTHQAPELLKGEIATPKADIYSFGITLWQMTTREVPYSG-EPQYVQYAVVAYNLR-- 292

  Fly   353 IPKTCPETWGA-------------LMKSCWQTDPHKRPGFKEILKQLES 388
                 |...||             :::|||:....:|||.:.:.|.|::
  Rat   293 -----PSLAGAVFTASLTGKTLQNIVQSCWEARALQRPGAELLQKDLKA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 79/300 (26%)
STKc_MLK 134..389 CDD:270963 80/299 (27%)
MosNP_064487.3 STKc_Mos 58..329 CDD:270881 78/299 (26%)
S_TKc 64..331 CDD:214567 78/295 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.