DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and MLKL

DIOPT Version :9

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_689862.1 Gene:MLKL / 197259 HGNCID:26617 Length:471 Species:Homo sapiens


Alignment Length:267 Identity:76/267 - (28%)
Similarity:128/267 - (47%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VHRGYYDGEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHENIAALRGVCLN-----TKLCL 202
            :::|.|....||||:..:.....:..:|....:|.|.....:..||..:.|:|::     .:..:
Human   217 LYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSI 281

  Fly   203 VMEYARGGSLNRIL-------AGKIPPDVLVNWAIQIARGMNYL-HNEAPMSIIHRDLKSSNVLI 259
            ||||...|:|..:|       .||  ..|||   :..|||:..| |:|||.  :|..::|||.|:
Human   282 VMEYCELGTLRELLDREKDLTLGK--RMVLV---LGAARGLYRLHHSEAPE--LHGKIRSSNFLV 339

  Fly   260 YEA----IEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVIS--VSTYSKFSDVWSY 318
            .:.    :.|..| :||......|..||  .|.|:.:.   |::.|:.:.  ...|...|:::|:
Human   340 TQGYQVKLAGFEL-RKTQTSMSLGTTRE--KTDRVKST---AYLSPQELEDVFYQYDVKSEIYSF 398

  Fly   319 GVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEIL 383
            |::|||:.||:.|::|.:...:...|||.....|:.:.||.....::..|...||..||...|||
Human   399 GIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEIL 463

  Fly   384 KQLESIA 390
            |:|.:.:
Human   464 KKLSTFS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 75/261 (29%)
STKc_MLK 134..389 CDD:270963 76/264 (29%)
MLKLNP_689862.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000269|PubMed:29883610 1..149
PHA02988 177..469 CDD:165291 76/264 (29%)
PKc_like 215..466 CDD:304357 75/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.