DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and sem-5

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:66 Identity:20/66 - (30%)
Similarity:39/66 - (59%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNVSS 114
            ||:|::.|...||..:||:::.:::.|     |..||.|::.::.|:||.::|.   |...|.|:
 Worm   161 ALFDFNPQESGELAFKRGDVITLINKD-----DPNWWEGQLNNRRGIFPSNYVC---PYNSNKSN 217

  Fly   115 A 115
            :
 Worm   218 S 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 17/53 (32%)
STKc_MLK 134..389 CDD:270963
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..151 CDD:199828
SH3_GRB2_like_C 158..210 CDD:212739 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.