DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and Grap2

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_034945.1 Gene:Grap2 / 17444 MGIID:1333842 Length:322 Species:Mus musculus


Alignment Length:112 Identity:36/112 - (32%)
Similarity:53/112 - (47%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQQQQQQQLEQLHHPQI-PEIPIPD------------------LEQVETQVGDGSLWT-ALYDYD 55
            |..|||:.|:..|..:. ..:.|.|                  .:.|:.|......|. ||||::
Mouse   211 QPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFE 275

  Fly    56 AQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFV 102
            |..||||..|.||:|.||.     |.:..||||::.:|:|:||.::|
Mouse   276 ALEEDELGFRSGEVVEVLD-----SSNPSWWTGRLHNKLGLFPANYV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 26/57 (46%)
STKc_MLK 134..389 CDD:270963
Grap2NP_034945.1 SH3 2..53 CDD:473055
SH2_Grb2_like 54..147 CDD:199828
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..216 2/4 (50%)
SH3_GRAP2_C 267..319 CDD:212883 26/56 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.