DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slpr and grap

DIOPT Version :10

Sequence 1:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001332868.1 Gene:grap / 100127598 XenbaseID:XB-GENE-6258733 Length:219 Species:Xenopus tropicalis


Alignment Length:62 Identity:21/62 - (33%)
Similarity:31/62 - (50%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALYDYDAQGEDELTLRRGEIVVVLSTDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLN 111
            |.||:.......|..|||:|:.||.     ..|..||.|:|....|:||:::|   .|:.:|
 Frog   164 ARYDFTPDQPTGLFFRRGDIIEVLD-----CSDPNWWRGRISGVTGMFPQNYV---HPIHVN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 19/53 (36%)
STKc_MLK 134..389 CDD:270963
grapNP_001332868.1 SH3_GRAP_N 2..55 CDD:212881
SH2_Grb2_like 56..152 CDD:199828
SH3_GRAP_C 161..213 CDD:212884 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.