DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgstl and Ptges

DIOPT Version :9

Sequence 1:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_071860.1 Gene:Ptges / 64292 MGIID:1927593 Length:153 Species:Mus musculus


Alignment Length:152 Identity:58/152 - (38%)
Similarity:82/152 - (53%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPVELLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPED-LMSPKLKVKFDDP 64
            |.|| .|:..|..|..:|.....:|||||..::::|...|.:.|.|||||| |....|:....||
Mouse     1 MPSP-GLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYYRSDP 64

  Fly    65 NVERVRRAHRNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRA 129
            :|||..||||||:|.|.||..:|.:|....|...:|...|..|...|:|||:.|...:.|: .|:
Mouse    65 DVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKLNPR-LRS 128

  Fly   130 LAFFVALGATVYMALQVIASAA 151
            .|:.:|..:...||||::...|
Mouse   129 GAYVLAQFSCFSMALQILWEVA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 50/128 (39%)
PtgesNP_071860.1 MAPEG 17..147 CDD:376462 51/130 (39%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 74..78 3/3 (100%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 127..131 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.