DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgstl and Ptges

DIOPT Version :9

Sequence 1:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_067594.1 Gene:Ptges / 59103 RGDID:62076 Length:153 Species:Rattus norvegicus


Alignment Length:146 Identity:55/146 - (37%)
Similarity:80/146 - (54%) Gaps:2/146 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPED-LMSPKLKVKFDDPNVERVR 70
            |:..::.|..:|.....:|||||..::::|...|.:.|.|||||| |....|:....||:|||..
  Rat     6 LVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYCRSDPDVERCL 70

  Fly    71 RAHRNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVA 135
            ||||||:|.|.||..:|.:|....|...:|...|..|...|:|||:.|...:.|: .|:.|:.:|
  Rat    71 RAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKMNPR-IRSGAYVLA 134

  Fly   136 LGATVYMALQVIASAA 151
            ..|...||||::...|
  Rat   135 QFACFSMALQILWEVA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 51/128 (40%)
PtgesNP_067594.1 MAPEG 17..147 CDD:395893 52/130 (40%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 74..78 3/3 (100%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 127..131 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.