DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgstl and mgst1.2

DIOPT Version :9

Sequence 1:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001002215.2 Gene:mgst1.2 / 431762 ZFINID:ZDB-GENE-040704-59 Length:152 Species:Danio rerio


Alignment Length:148 Identity:61/148 - (41%)
Similarity:91/148 - (61%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPEDL---MSPKLKVKF--DDPNVERV 69
            :::.||.:|..:..::::||:.|:.||...||..|.|:|.||.   .:|:.:.|.  .:|:||||
Zfish     5 MNSDVFLAFCTYATIVILKMMFMAPLTGYFRFTRKAFSNWEDTAMSKNPEARKKMLQTNPDVERV 69

  Fly    70 RRAHRNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRALAFFV 134
            ||.|.||||||:||..|||||.||.|....|:..||....:|.:||..| |:.:|||||.|::.|
Zfish    70 RRCHLNDLENIIPFVVIGLLYALTGPDLSTALLHFRVFVGSRFIHTASY-VLALPQPSRGLSWVV 133

  Fly   135 ALGATVYMALQVIASAAF 152
            .:..|..||.:|:.:|.:
Zfish   134 GMITTFSMAYRVLTTALY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 57/132 (43%)
mgst1.2NP_001002215.2 MAPEG 15..146 CDD:279468 56/131 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580252
Domainoid 1 1.000 108 1.000 Domainoid score I6364
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10544
Inparanoid 1 1.050 118 1.000 Inparanoid score I4774
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 1 0.900 - - OOG6_105982
Panther 1 1.100 - - LDO PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.