DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgstl and CG33178

DIOPT Version :9

Sequence 1:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001285263.1 Gene:CG33178 / 318913 FlyBaseID:FBgn0053178 Length:177 Species:Drosophila melanogaster


Alignment Length:158 Identity:89/158 - (56%)
Similarity:108/158 - (68%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPVELLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTK------------TFANPEDLM 53
            |.||.::.:|.||||..:.||..|||:||||||||||:|||:.|            .|.|.|||.
  Fly    12 MTSPGDMFTLENPVFCCYLFWSTVLVVKMLLMSLLTAVQRFRYKLLAIVPLALRRRIFPNQEDLF 76

  Fly    54 SPKLKVKFDDPNVERVRRAHRNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVY 118
            ...|:|:||||:|||||||||||:|||||:|.:.|:|:.|:|.|.:|..|||...:|||:|||||
  Fly    77 FKNLEVQFDDPHVERVRRAHRNDMENILPYFIMSLIYISTNPNADVACILFRVASVARIIHTLVY 141

  Fly   119 AVVVVPQPSRALAFFVALGATVYMALQV 146
            ||..||||||.|||...|..|.|||..|
  Fly   142 AVYPVPQPSRILAFATMLLITFYMAAVV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 81/139 (58%)
CG33178NP_001285263.1 MAPEG 29..171 CDD:395893 81/141 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448350
Domainoid 1 1.000 108 1.000 Domainoid score I6364
eggNOG 1 0.900 - - E1_2B1WH
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115176at33392
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
109.900

Return to query results.
Submit another query.