DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mgstl and ptges

DIOPT Version :9

Sequence 1:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001107136.1 Gene:ptges / 100038203 XenbaseID:XB-GENE-484896 Length:145 Species:Xenopus tropicalis


Alignment Length:143 Identity:57/143 - (39%)
Similarity:89/143 - (62%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPEDLM-SPKLKVKFDDPNVERVRRAH 73
            :.:.||.||.|:..:|::||.:::::|...|.:.|.||||||.| ...::....||:|||.||||
 Frog     1 MMDEVFASFVFYSTLLILKMYIIAVITGQIRLRKKAFANPEDAMRHGGIQYYRQDPDVERYRRAH 65

  Fly    74 RNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVALGA 138
            .||:|||.||..:|.:|.|.||...:|...|:...|.|::||:.|.:.:.| |:|::|:.:|...
 Frog    66 NNDMENIYPFLFLGAMYSLLDPNPTIARIHFQIFFICRVLHTVAYVLPLKP-PTRSVAYSIAQLP 129

  Fly   139 TVYMALQVIASAA 151
            ...||||::.|.|
 Frog   130 CFSMALQILYSVA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 51/128 (40%)
ptgesNP_001107136.1 MAPEG 9..139 CDD:376462 52/130 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4794
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9476
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.