DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and KNAT7

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_564805.1 Gene:KNAT7 / 842602 AraportID:AT1G62990 Length:291 Species:Arabidopsis thaliana


Alignment Length:322 Identity:62/322 - (19%)
Similarity:99/322 - (30%) Gaps:140/322 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVGPTEGKQPPSE-SFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSL 65
            ||...:.:|...| :..|.:.|::|                ..:.|.         |:|..:..|
plant    20 AVVAEQNRQLKGEIATHPMYEQLLA----------------AHVACL---------RVATPIDQL 59

  Fly    66 PV---ALPNMHEILNCEAVLRARAVVAYH-----VGNFRELYAIIENHKFTKASYGKLQAMWLEA 122
            |:   .|...|.:|..    .|...|.||     :.||...|.::      ..|:.:.....:..
plant    60 PIIEAQLSQSHHLLRS----YASTAVGYHHDRHELDNFLAQYVMV------LCSFKEQLQQHVRV 114

  Fly   123 HYIEA-----------EKLRGRSLG--------------PVD----------------------- 139
            |.:||           ..|.|.:||              |:|                       
plant   115 HAVEAVMACREIENNLHSLTGATLGEGSGATMSEDEDDLPMDFSSDNSGVDFSGGHDMTGFGPLL 179

  Fly   140 --------KYRVRKKFPLPPTIWDGEQKTHCFKER--------------------TRSLLREWYL 176
                    ..|||::..|        :....||.|                    |.::|:.|:.
plant   180 PTESERSLMERVRQELKL--------ELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQ 236

  Fly   177 QD---PYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRR 235
            |.   |||....|.:|.:.|||...|:.|||.|:|:|:         .|:.:.|....:|:|
plant   237 QHCKWPYPTEDDKAKLVEETGLQLKQINNWFINQRKRN---------WHNNSHSLTSLKSKR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 28/176 (16%)
homeodomain 158..206 CDD:238039 19/70 (27%)
KNAT7NP_564805.1 KNOX1 29..67 CDD:281744 9/62 (15%)
KNOX2 84..134 CDD:281745 8/55 (15%)
Homeobox_KN 234..273 CDD:283551 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.