DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six2a

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_571858.1 Gene:six2a / 83415 ZFINID:ZDB-GENE-010412-1 Length:288 Species:Danio rerio


Alignment Length:320 Identity:145/320 - (45%)
Similarity:191/320 - (59%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFR 96
            :||..|:..||..||:.|:..|:||||.||||||| |..::|:   .|:||:|:||||:|.||||
Zfish     4 LPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLP-ACEHLHK---NESVLKAKAVVAFHRGNFR 64

  Fly    97 ELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTH 161
            |||.|:|:|:|:..::.|||.:||:||||||||||||.||.|.|||||:|||||.:|||||:.::
Zfish    65 ELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSY 129

  Fly   162 CFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226
            ||||::||:|||||..:|||:|.:|||||:||||..|||.|||||||||||||.||.| ::::||
Zfish   130 CFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER-ENNENS 193

  Fly   227 SGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDREESL-SVDDDK 290
                                      :..:|:|:.||:             |..:..| |.||||
Zfish   194 --------------------------NTNSHNPLTSSM-------------NGNKTILGSSDDDK 219

  Fly   291 PRDLSGSLPLPLSLPLPLASPTHT---PPQLPPGYGGGAGAGPGGPLTGPGCLPPFKLDA 347
                           .|..:|.||   |..|.....|........|..||..:|...:|:
Zfish   220 ---------------TPSGTPDHTSSSPALLLTSNSGLQSLHGLAPPPGPSAIPVPSVDS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 68/112 (61%)
homeodomain 158..206 CDD:238039 30/47 (64%)
six2aNP_571858.1 SIX1_SD 9..118 CDD:293483 68/112 (61%)
homeodomain 129..180 CDD:238039 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.