DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and KNAT4

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_196667.2 Gene:KNAT4 / 830973 AraportID:AT5G11060 Length:393 Species:Arabidopsis thaliana


Alignment Length:280 Identity:64/280 - (22%)
Similarity:110/280 - (39%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTHHQIIA--------PSPILAVPTLAFSAAQVE-IVCK--TLED-----SGDIERLARFLWSLP 66
            |.:.|:::        .:|:..:|.:....||.: :|.|  |||.     :||.:.|..|:....
plant   131 PLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQGLLAGDDKELDHFMTHYV 195

  Fly    67 VALPNMHEILNCEAVLRA-RAVVA-YHVGNFRELYAIIENHKFTKASYGKLQAMWLE--AHYIEA 127
            :.|.:..|.|.....:.| .||:| :.:....:.:..:...:.|.|:..:.:...:|  ||..:.
plant   196 LLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESDAHLFDG 260

  Fly   128 EKLRGRSLGPVD--------KYRVRKKFPLPPTIWDGEQKTHCFKER------------------ 166
             .|.|...||:.        ..|||::  |...:..|      :||:                  
plant   261 -SLDGLGFGPLVPTESERSLMERVRQE--LKHELKQG------YKEKIVDIREEILRKRRAGKLP 316

  Fly   167 --TRSLLREWYLQD---PYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226
              |.|:|:.|:...   |||....|..|.:.|||...|:.|||.|:|:|:         .||..|
plant   317 GDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN---------WHSNPS 372

  Fly   227 SGMGCRSRRADGAASPTPSD 246
            |....:::|...|...:..|
plant   373 SSTVSKNKRRSNAGENSGRD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 30/132 (23%)
homeodomain 158..206 CDD:238039 18/70 (26%)
KNAT4NP_196667.2 KNOX1 124..161 CDD:281744 4/29 (14%)
KNOX2 182..231 CDD:281745 11/48 (23%)
ELK 286..307 CDD:281743 4/28 (14%)
Homeobox_KN 326..365 CDD:283551 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.