DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and ATH1

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001328067.1 Gene:ATH1 / 829435 AraportID:AT4G32980 Length:473 Species:Arabidopsis thaliana


Alignment Length:84 Identity:27/84 - (32%)
Similarity:36/84 - (42%) Gaps:29/84 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GEQKT--------HC------------------FKERTRSLLREWYLQD---PYPNPTKKRELAK 191
            |:.||        ||                  ..|::.|:||.|..|:   |||..::|..||.
plant   346 GKDKTQETSMFHQHCLLQQLKRKNHQIWRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAI 410

  Fly   192 ATGLNPTQVGNWFKNRRQR 210
            .:||..:||.|||.|.|.|
plant   411 RSGLTRSQVSNWFINARVR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483
homeodomain 158..206 CDD:238039 23/76 (30%)
ATH1NP_001328067.1 POX 196..334 CDD:214728
Homeobox_KN 390..429 CDD:399131 17/38 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.