DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and KNAT5

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_194932.1 Gene:KNAT5 / 829335 AraportID:AT4G32040 Length:383 Species:Arabidopsis thaliana


Alignment Length:295 Identity:66/295 - (22%)
Similarity:109/295 - (36%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VGPTEGKQPPSESFS------PTHHQIIA--------PSPILAVPTLAFSAAQVEIVCKTLEDSG 53
            :|...|:...|.|:.      |.:.|::|        .:|:..:|.:....:|:..|.......|
plant   105 LGVVGGEDWRSASYKAAILRHPMYEQLLAAHVACLRVATPVDQIPRIDAQLSQLHTVAAKYSTLG 169

  Fly    54 ---DIERLARFLWSLPVALPNMHEILNCEAVLRA-RAVVA-YHV-GNFRELYAIIENHKFTKASY 112
               |.:.|..|:....|.|.:..|.|.....:.| .|:.| :.: .:.:.|..:..:.     |.
plant   170 VVVDNKELDHFMSHYVVLLCSFKEQLQHHVCVHAMEAITACWEIEQSLQSLTGVSPSE-----SN 229

  Fly   113 GKLQAMWLEAHYIEAE------KLRGRS-------LGPVDKYR---VRKKFPLPPTIWDGEQKTH 161
            ||..:...:.:.:|:|      .|.|..       |.|.::.|   .|.|..|...:..|     
plant   230 GKTMSDDEDDNQVESEVNMFDGSLDGSDCLMGFGPLVPTERERSLMERVKKELKHELKQG----- 289

  Fly   162 CFKER--------------------TRSLLREWYLQD---PYPNPTKKRELAKATGLNPTQVGNW 203
             |||:                    |.|:|:||:...   |||....|.:|.:.|||...|:.||
plant   290 -FKEKIVDIREEIMRKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKLVQETGLQLKQINNW 353

  Fly   204 FKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRRADG 238
            |.|:|:|       |...:|..||.:....|:..|
plant   354 FINQRKR-------NWNSNSSTSSTLTKNKRKRTG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 26/134 (19%)
homeodomain 158..206 CDD:238039 20/70 (29%)
KNAT5NP_194932.1 KNOX1 117..156 CDD:397730 6/38 (16%)
KNOX2 170..221 CDD:397731 10/50 (20%)
Homeobox_KN 321..360 CDD:399131 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.