powered by:
Protein Alignment Optix and AT4G12750
DIOPT Version :9
Sequence 1: | NP_001260793.1 |
Gene: | Optix / 44108 |
FlyBaseID: | FBgn0025360 |
Length: | 492 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001319916.1 |
Gene: | AT4G12750 / 826887 |
AraportID: | AT4G12750 |
Length: | 1117 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 23/74 - (31%) |
Similarity: | 31/74 - (41%) |
Gaps: | 17/74 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 LREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRR 235
|..:||:..||.|.:..:|.|:.||...:|..|||.||.| |.|.:|..
plant 12 LEGFYLEQMYPTPKEMEDLGKSLGLTLKEVRGWFKRRRSR-----------------GKGVKSMA 59
Fly 236 ADGAASPTP 244
.||..:..|
plant 60 NDGLGAKNP 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Optix | NP_001260793.1 |
SIX1_SD |
37..150 |
CDD:293483 |
|
homeodomain |
158..206 |
CDD:238039 |
13/34 (38%) |
AT4G12750 | NP_001319916.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
48 |
1.000 |
Domainoid score |
I4491 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10390 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.