DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and AT4G12750

DIOPT Version :10

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001319916.1 Gene:AT4G12750 / 826887 AraportID:AT4G12750 Length:1117 Species:Arabidopsis thaliana


Alignment Length:74 Identity:23/74 - (31%)
Similarity:31/74 - (41%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 LREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRR 235
            |..:||:..||.|.:..:|.|:.||...:|..|||.||.|                 |.|.:|..
plant    12 LEGFYLEQMYPTPKEMEDLGKSLGLTLKEVRGWFKRRRSR-----------------GKGVKSMA 59

  Fly   236 ADGAASPTP 244
            .||..:..|
plant    60 NDGLGAKNP 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:465293
homeodomain 158..206 CDD:238039 13/34 (38%)
AT4G12750NP_001319916.1 homeodomain 3..51 CDD:238039 16/38 (42%)
DDT 352..397 CDD:460696
HARE-HTH 492..559 CDD:480770
WHIM1 629..672 CDD:464774
WSD 753..828 CDD:464775
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.