DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Optix and KNAT1

DIOPT Version :9

Sequence 1:	NP_001260793.1	Gene:	Optix / 44108	FlyBaseID:	FBgn0025360	Length:	492	Species:	Drosophila melanogaster
Sequence 2:	NP_192555.1	Gene:	KNAT1 / 826364	AraportID:	AT4G08150	Length:	398	Species:	Arabidopsis thaliana

Alignment Length:	140	Identity:	39/140 - (27%)
Similarity:	60/140 - (42%)	Gaps:	44/140 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            |||    :||...|.| |.|.::..|..                  :.:||..||
plant   278 REL----KNHLLKKYS-GYLSSLKQELS------------------KKKKKGKLP---------- 309

  Fly   161 HCFKERTRSLLREWYL--QDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQR------DRAAAAK 217
               ||..:.||..|.|  :.|||:.::|..||::|||:..|:.|||.|:|:|      |......
plant   310 ---KEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKPSEDMQFMVM 371

  Fly   218 NRIQHSQNSS 227
            :.:||..:::
plant   372 DGLQHPHHAA 381

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Optix	NP_001260793.1	SIX1_SD	37..150	CDD:293483	12/53 (23%)
Optix	NP_001260793.1	homeodomain	158..206	CDD:238039	19/49 (39%)
KNAT1	NP_192555.1	KNOX1	133..172	CDD:281744
		KNOX2	189..234	CDD:281745
		ELK	279..300	CDD:281743	9/25 (36%)
		Homeobox_KN	319..358	CDD:283551	17/38 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	78	1.000	Inparanoid score	I2393
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050