DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and SIX3

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_005404.1 Gene:SIX3 / 6496 HGNCID:10889 Length:332 Species:Homo sapiens


Alignment Length:253 Identity:175/253 - (69%)
Similarity:192/253 - (75%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GKQPPSESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNM 72
            |.:.|.|..|           :..:|||.||..||..||:|||::||||||.||||||||| |..
Human    69 GSRAPPEELS-----------MFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVA-PGA 121

  Fly    73 HEILN-CEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLG 136
            .|.:| .|::||||||||:|.||||:||.|:|||||||.|:||||||||||||.||||||||.||
Human   122 CEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLG 186

  Fly   137 PVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVG 201
            ||||||||||||||.||||||||||||||||||||||||||||||||:||||||:||||.|||||
Human   187 PVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVG 251

  Fly   202 NWFKNRRQRDRAAAAKNRIQHSQ-NSSGM------GC----RSRRADGAASPTPSDSS 248
            ||||||||||||||||||:||.. ..|||      ||    .:.....|||||.|.||
Human   252 NWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 86/113 (76%)
homeodomain 158..206 CDD:238039 44/47 (94%)
SIX3NP_005404.1 Interaction with TLE5. /evidence=ECO:0000250|UniProtKB:Q62233 72..119 30/58 (52%)
SIX1_SD 87..200 CDD:374862 86/113 (76%)
homeodomain 208..256 CDD:238039 44/47 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..251 15/18 (83%)
Bind to RHO promoter. /evidence=ECO:0000250|UniProtKB:Q62233 232..234 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..332 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158081
Domainoid 1 1.000 175 1.000 Domainoid score I3653
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm41628
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.