DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and SIX1

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_005973.1 Gene:SIX1 / 6495 HGNCID:10887 Length:284 Species:Homo sapiens


Alignment Length:283 Identity:135/283 - (47%)
Similarity:183/283 - (64%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFR 96
            :|:..|:..||..||:.|:..|::|||.||||||| |..::|:   .|:||:|:||||:|.||||
Human     4 LPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLP-ACDHLHK---NESVLKAKAVVAFHRGNFR 64

  Fly    97 ELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTH 161
            |||.|:|:|:|:..::.|||.:||:|||:||||||||.||.|.|||||:|||||.||||||:.::
Human    65 ELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSY 129

  Fly   162 CFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226
            ||||::|.:|||||..:|||:|.:|||||:||||..|||.|||||||||||||.||.|.....|:
Human   130 CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNN 194

  Fly   227 SGMGCRSRRADGAASPTPSDSSDSDIS-LGTHSPVPSSLQLQHSPGSTSNGANDREESLSVDDDK 290
            |                 |.:..:.:| |....|:.||.:.:.||..:.    |:...|.:..:.
Human   195 S-----------------SSNKQNQLSPLEGGKPLMSSSEEEFSPPQSP----DQNSVLLLQGNM 238

  Fly   291 PRDLSGSLPLPLSLPLPLASPTH 313
            ....|.:..||   .|..:.|:|
Human   239 GHARSSNYSLP---GLTASQPSH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 66/112 (59%)
homeodomain 158..206 CDD:238039 29/47 (62%)
SIX1NP_005973.1 SIX1_SD 9..118 CDD:374862 66/112 (59%)
homeodomain 129..180 CDD:238039 35/50 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..269 35/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.