DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six2b

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001122206.1 Gene:six2b / 566454 ZFINID:ZDB-GENE-080723-23 Length:285 Species:Danio rerio


Alignment Length:298 Identity:139/298 - (46%)
Similarity:183/298 - (61%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRE 97
            ||..|:..||..||:.|:..|.||||.||||||| |..::|:   .|:||:|:||||:|.|||||
Zfish     5 PTFGFTQEQVACVCEVLQQGGSIERLGRFLWSLP-ACEHLHK---NESVLKAKAVVAFHRGNFRE 65

  Fly    98 LYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHC 162
            ||.::|:|:|:..::.|||.:||:||||||||||||.||.|.|||||:|||||.:|||||:.::|
Zfish    66 LYKVLESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYC 130

  Fly   163 FKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSS 227
            |||::|.:|:|||..:|||:|.:|||||:||||..|||.|||||||||||||.||.|.....|.:
Zfish   131 FKEKSRCVLKEWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENEGANPN 195

  Fly   228 GMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDREESL--SVDDDK 290
            |                            |:|:.|.:              :..:||  |.||||
Zfish   196 G----------------------------HNPLTSHV--------------NENKSLCESSDDDK 218

  Fly   291 P-------RDLSGSLPLPLSLPLPLASPTHT--PPQLP 319
            .       .::|.::.:|.|..||   |.|:  ||..|
Zfish   219 SPAGTPDHTNMSPAILMPSSSGLP---PLHSFAPPPGP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 67/112 (60%)
homeodomain 158..206 CDD:238039 28/47 (60%)
six2bNP_001122206.1 SIX1_SD 9..118 CDD:293483 67/112 (60%)
homeodomain 129..180 CDD:238039 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.