DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and SIX6

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_031400.2 Gene:SIX6 / 4990 HGNCID:10892 Length:246 Species:Homo sapiens


Alignment Length:251 Identity:169/251 - (67%)
Similarity:193/251 - (76%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVVAYHVGNF 95
            :|.|.||..||..||:|||:|||:|||.||||||||| |...|.|| .|:||||||:||:|.||:
Human     4 LPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVA-PAACEALNKNESVLRARAIVAFHGGNY 67

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            ||||.|:|||||||.|:.||||:||||||.||||||||.||||||||||||||||.|||||||||
Human    68 RELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT 132

  Fly   161 HCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQN 225
            ||||||||.||||||||||||||:||||||:||||.|||||||||||||||||||||||:|....
Human   133 HCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVL 197

  Fly   226 SSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDRE 281
            |.|.| |:.||:|..:|.         .||..:...:||..:.:..:.|..::|.|
Human   198 SQGSG-RALRAEGDGTPE---------VLGVATSPAASLSSKAATSAISITSSDSE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 85/113 (75%)
homeodomain 158..206 CDD:238039 43/47 (91%)
SIX6NP_031400.2 SIX1_SD 9..122 CDD:318970 85/113 (75%)
homeodomain 130..178 CDD:238039 43/47 (91%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..246 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158078
Domainoid 1 1.000 175 1.000 Domainoid score I3653
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm41628
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.