DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six1b

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_996978.1 Gene:six1b / 404627 ZFINID:ZDB-GENE-040426-2308 Length:284 Species:Danio rerio


Alignment Length:283 Identity:141/283 - (49%)
Similarity:187/283 - (66%) Gaps:15/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFR 96
            :|:..|:..||..||:.|:..|::|||.||||||| |..::|:   .|:||:|:||||:|.||||
Zfish     4 LPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLP-ACDHLHK---NESVLKAKAVVAFHRGNFR 64

  Fly    97 ELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTH 161
            |||.|:|:|:|:..::.|||.:||:||||||||||||.||.|.|||||:|||||.||||||:.::
Zfish    65 ELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSY 129

  Fly   162 CFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNS 226
            ||||::|.:|||||..:|||:|.:|||||:||||..|||.|||||||||||||.||.|.....|:
Zfish   130 CFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENSENNN 194

  Fly   227 SGMGCRSRRA--DGAASPTPSDSSDSDISLGTHSPVPSSLQL----QHSPGSTSNGANDREESLS 285
            :|...:::.:  ||..|..   ||..|......||..:|:.|    ...||:::........:.|
Zfish   195 TGANKQNQLSPLDGGKSLM---SSSEDEFSPPQSPDQNSVLLLQGNMSHPGASAYSMTGLGAAQS 256

  Fly   286 VD--DDKPRDLSGSLPLPLSLPL 306
            |.  ...|..|..||..||:..|
Zfish   257 VHGMQGHPHQLQDSLLGPLTSSL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 67/112 (60%)
homeodomain 158..206 CDD:238039 29/47 (62%)
six1bNP_996978.1 SIX1_SD 9..118 CDD:407119 67/112 (60%)
homeodomain 129..180 CDD:238039 35/50 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..238 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.