DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six3b

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_571438.1 Gene:six3b / 30636 ZFINID:ZDB-GENE-990415-128 Length:293 Species:Danio rerio


Alignment Length:289 Identity:177/289 - (61%)
Similarity:205/289 - (70%) Gaps:20/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PSESFSPTHHQ---IIAPS----------PILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLW 63
            ||..|.|....   ::|.|          |:..:|||.|||.||..||:|||::||||||.||||
Zfish    11 PSHLFLPNFADRPLLLAGSIPRARSPEDLPMFQLPTLNFSAEQVASVCETLEETGDIERLGRFLW 75

  Fly    64 SLPVALPNMHEILN-CEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEA 127
            ||||| |...:.:| .|::.|||||||||.|:|||||.|:|.|||||.|:||||||||||||.||
Zfish    76 SLPVA-PGACDAINKHESIQRARAVVAYHTGSFRELYHILETHKFTKDSHGKLQAMWLEAHYQEA 139

  Fly   128 EKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKA 192
            ||||||.||||||||||||||||.|||||||||||||||||.||||||||||||||:||||||:|
Zfish   140 EKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQA 204

  Fly   193 TGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRRADGAASPTPSDSSDSDISLGTH 257
            |||.|||||||||||||||||||||||:||    .|:|..|.|:...:..||..|::|..:..:.
Zfish   205 TGLTPTQVGNWFKNRRQRDRAAAAKNRLQH----HGLGQSSLRSMSESGCTPHSSAESPCAAASP 265

  Fly   258 SPVPSSLQLQHSPGSTSNGANDREESLSV 286
            :...||:. :...|.|.....|.:....|
Zfish   266 TTSVSSMN-ERGDGGTILSVTDSDSDFDV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 85/113 (75%)
homeodomain 158..206 CDD:238039 43/47 (91%)
six3bNP_571438.1 SIX1_SD 49..162 CDD:293483 85/113 (75%)
homeodomain 170..218 CDD:238039 43/47 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593951
Domainoid 1 1.000 175 1.000 Domainoid score I3584
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122422
Inparanoid 1 1.050 334 1.000 Inparanoid score I2392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm24942
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.