DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six3a

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_571437.1 Gene:six3a / 30635 ZFINID:ZDB-GENE-990415-127 Length:294 Species:Danio rerio


Alignment Length:275 Identity:181/275 - (65%)
Similarity:200/275 - (72%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PSESFSPTHHQIIAPSPIL-----------------AVPTLAFSAAQVEIVCKTLEDSGDIERLA 59
            ||..|.|.    .|..|:|                 .:|||.||..||..||:|||::||||||.
Zfish    11 PSHFFLPN----FADRPLLLASSAPSTRSPEDLSMFQLPTLNFSPEQVASVCETLEETGDIERLG 71

  Fly    60 RFLWSLPVALPNMHEILN-CEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAH 123
            ||||||||| |...|.:| .|::||||||||:|.||||:||.|:|||||||.|:|||||||||||
Zfish    72 RFLWSLPVA-PGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAH 135

  Fly   124 YIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRE 188
            |.||||||||.||||||||||||||||.||||||||||||||||||||||||||||||||:||||
Zfish   136 YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRE 200

  Fly   189 LAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQH---SQNS----SGMGCRSRRA----DGAASP 242
            ||:||||.|||||||||||||||||||||||:||   .||.    |..||..|.:    ..||||
Zfish   201 LAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGQNGMRSLSESGCAPRSSAESPSTAASP 265

  Fly   243 TPSDSSDSD-ISLGT 256
            |.|.||.:: :..||
Zfish   266 TTSVSSMTERVDTGT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 86/113 (76%)
homeodomain 158..206 CDD:238039 44/47 (94%)
six3aNP_571437.1 SIX1_SD 49..162 CDD:293483 86/113 (76%)
homeodomain 170..218 CDD:238039 44/47 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593950
Domainoid 1 1.000 175 1.000 Domainoid score I3584
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 334 1.000 Inparanoid score I2392
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm24942
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.