DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and six9

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001124080.1 Gene:six9 / 30623 ZFINID:ZDB-GENE-990621-11 Length:235 Species:Danio rerio


Alignment Length:231 Identity:113/231 - (48%)
Similarity:149/231 - (64%) Gaps:14/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEIL----NCEAVLRARAVVAYHVGNF 95
            :.||..||..||:.|..||.::||:.||.|||....:.:..:    :.|:||:|||.||:|...|
Zfish     3 MGFSPEQVACVCEVLLQSGSMDRLSSFLCSLPSISTSSNMYMGFGQSQESVLKARAAVAFHHCRF 67

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            .||||::|.:.|:..|:..||.:||.|||:|||..|||.||.|.|||:|:|||||.||||||:.:
Zfish    68 TELYALLEGNVFSPRSHPLLQQLWLRAHYMEAELQRGRPLGAVGKYRIRRKFPLPRTIWDGEETS 132

  Fly   161 HCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQN 225
            :||||::||:|||||.:.|||:|.:||:||.||||..|||.|||||||||||||.::      |.
Zfish   133 YCFKEKSRSVLREWYCRKPYPSPREKRDLAAATGLTATQVSNWFKNRRQRDRAATSR------QG 191

  Fly   226 SSGMGCRSRRADGAASP--TPSDSSDSDISLGTHSP 259
            :|.....|  :|...||  :|.........|..|.|
Zfish   192 TSAGAFLS--SDEEISPPGSPRTLFSCSQQLSAHPP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 56/116 (48%)
homeodomain 158..206 CDD:238039 29/47 (62%)
six9NP_001124080.1 SIX1_SD 5..122 CDD:293483 56/116 (48%)
homeodomain 133..184 CDD:238039 35/50 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.