DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Optix and Six6

DIOPT Version :9

Sequence 1:NP_001260793.1 Gene:Optix / 44108 FlyBaseID:FBgn0025360 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_035514.1 Gene:Six6 / 20476 MGIID:1341840 Length:246 Species:Mus musculus


Alignment Length:251 Identity:169/251 - (67%)
Similarity:192/251 - (76%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVVAYHVGNF 95
            :|.|.||..||..||:|||:|||:|||.||||||||| |...|.|| .|:||||||:||:|.||:
Mouse     4 LPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVA-PAACEALNKNESVLRARAIVAFHGGNY 67

  Fly    96 RELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKT 160
            ||||.|:|||||||.|:.||||:||||||.||||||||.||||||||||||||||.|||||||||
Mouse    68 RELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKT 132

  Fly   161 HCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQN 225
            ||||||||.||||||||||||||:||||||:||||.|||||||||||||||||||||||:|....
Mouse   133 HCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVL 197

  Fly   226 SSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDRE 281
            |.|.| |..|::|..:|.         .||..|...:||..:.:..:.|..::|.|
Mouse   198 SQGPG-RVLRSEGEGTPE---------VLGVASSPAASLSSKAATSAISITSSDSE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OptixNP_001260793.1 SIX1_SD 37..150 CDD:293483 85/113 (75%)
homeodomain 158..206 CDD:238039 43/47 (91%)
Six6NP_035514.1 SIX1_SD 9..122 CDD:407119 85/113 (75%)
homeodomain 130..178 CDD:238039 43/47 (91%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..246 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848462
Domainoid 1 1.000 175 1.000 Domainoid score I3634
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 321 1.000 Inparanoid score I2501
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002292
OrthoInspector 1 1.000 - - otm43673
orthoMCL 1 0.900 - - OOG6_105562
Panther 1 1.100 - - LDO PTHR10390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2573
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.